CookSnap is coming soon — Join the waitlist →
Back to recipes

Butter & Sage Pumpkin Tortelli

Tender store-bought tortelli filled with sweet pumpkin, finished in brown butter and crispy sage. Ready in 20 minutes—no homemade pasta required.

Total time
20 min
Servings
2
Calories
520
Protein
18g
Butter & Sage Pumpkin Tortelli
elegantsimpleitalianvegetarianvegetariantendercreamyweeknight

Ingredients

  • 1 lb pumpkin tortelli (store-bought)
  • 3 tbsp butter
  • 8 leaves fresh sage leaves
  • 2 cloves garlic, minced
  • ½ cup parmesan, grated
  • 1 pinch salt and black pepper
  • ½ lemon lemon, zested

Instructions

  1. 1

    Bring a large pot of salted water to a boil. Add tortelli and cook until they float, then 1 minute more—about 4 minutes total.

  2. 2

    While tortelli cook, melt butter in a large skillet over medium heat. Add garlic and cook 30 seconds until fragrant.

  3. 3

    Add sage leaves to the skillet and cook until edges crisp and butter turns golden brown, about 2 minutes.

  4. 4

    Drain tortelli, reserving 1 cup pasta water. Transfer tortelli to the skillet with the brown butter.

  5. 5

    Toss gently to coat. Add a splash of pasta water if needed—sauce should be glossy, not soupy.

  6. 6

    Divide between bowls, top with parmesan and lemon zest. Season with salt and pepper.

Tools you’ll need

  • large pot
  • large skillet
  • wooden spoon
  • colander
  • microplane or zester

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.