CookSnap is coming soon — Join the waitlist →
Back to recipes

Pumpkin Risotto

Creamy, buttery risotto infused with roasted pumpkin purée and finished with crispy sage. A elegant vegetarian Italian dish ready in 45 minutes.

Total time
45 min
Servings
4
Calories
485
Protein
14g
Pumpkin Risotto
comfortelegantitalianvegetariancheesecreamytenderweeknight

Ingredients

  • 1 cup pumpkin purée (or roasted butternut squash purée)
  • 5 cups vegetable broth
  • 1.5 cups arborio rice
  • 1 medium yellow onion, diced small
  • 5 tablespoons butter, divided
  • ¾ cup parmesan cheese, grated
  • 8 leaves fresh sage leaves
  • 1 pinch salt and pepper to taste

Instructions

  1. 1

    Pour the vegetable broth into a medium pot and set it over medium heat until small bubbles steadily break the surface, about 5 minutes. This keeps the broth warm so the risotto cooks evenly.

  2. 2

    Heat 3 tablespoons of butter in a large 12-inch skillet over medium heat until it foams and stops crackling, about 1 minute.

  3. 3

    Add the diced onion to the foaming butter and stir once every 15 seconds until the pieces turn translucent and smell sweet, about 3 minutes.

  4. 4

    Pour the arborio rice into the skillet and stir constantly for 2 minutes until the grains are coated with butter and smell slightly toasted.

  5. 5

    Add 1 cup of the warm broth to the rice and stir frequently, scraping the bottom and sides, until the liquid is almost completely absorbed and the rice looks creamy, about 3 minutes.

  6. 6

    Add another 1 cup of broth and repeat the frequent stirring until the liquid is nearly gone, about 3 minutes. Continue adding broth 1 cup at a time, stirring frequently between each addition, for 15 minutes total.

  7. 7

    Stir the pumpkin purée into the risotto, then add the remaining broth in two 1-cup additions, stirring frequently between each pour, for 4 more minutes until the rice is tender and creamy.

  8. 8

    Remove the skillet from heat and stir in the remaining 2 tablespoons of butter and the grated parmesan until the cheese melts and the risotto looks glossy, about 1 minute.

  9. 9

    Taste the risotto and add salt and pepper in small pinches until it tastes balanced and savory.

  10. 10

    Place a small skillet over medium-high heat and add the 8 sage leaves directly to the dry pan, pressing them flat with the back of a spoon, cooking for 30 seconds until they darken and smell strongly fragrant.

  11. 11

    Divide the risotto evenly among four bowls and garnish each with 2 crispy sage leaves, placing them in the center of each serving.

Tools you’ll need

  • medium pot
  • large 12-inch skillet with a wooden spoon for stirring
  • measuring cups and tablespoons
  • grater or microplane for parmesan
  • small skillet

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.