CookSnap is coming soon — Join the waitlist →
Back to recipes

Creamy Mushroom Risotto

Tender arborio rice cooked with mushrooms, broth, and butter until rich and creamy. A classic Italian one-pan dinner that feels fancy but takes just 30 minutes.

Total time
30 min
Servings
2
Calories
512
Protein
18g
Creamy Mushroom Risotto
comfortelegantitalianvegetarianvegetariancreamytenderweeknight

Ingredients

  • 8 oz mushrooms, mixed varieties
  • 1 cup arborio rice
  • 4 cups vegetable broth
  • 3 tablespoons butter
  • ½ cup parmesan cheese, finely grated
  • to taste salt and pepper

Instructions

  1. 1

    Place mushrooms on the cutting board stem-side down and slice straight down through the cap into 1/4-inch-thick slices, like cutting bread, until all mushrooms are sliced.

  2. 2

    Pour the 4 cups vegetable broth into a small pot and place it on the stove over medium heat, leaving it there until needed so it stays warm.

  3. 3

    Place a 12-inch skillet over medium-high heat and add 1 tablespoon butter, swirling until the butter melts completely and coats the pan, about 20 seconds.

  4. 4

    Add the sliced mushrooms to the hot pan and cook, stirring once every 30 seconds, until the surfaces turn golden-brown and the mushrooms release their liquid, about 5 minutes.

  5. 5

    Slide the cooked mushrooms onto a plate and set aside, leaving any liquid in the pan.

  6. 6

    Add 1 tablespoon butter to the same skillet and pour in the 1 cup arborio rice, then stir constantly for 1 minute until the rice grains look opaque white instead of translucent.

  7. 7

    Pour 1 cup of the warm broth into the rice and stir gently but continuously until almost all the liquid is absorbed and the rice looks creamy, about 4 minutes.

  8. 8

    Pour another 1 cup warm broth into the pan and stir constantly for about 4 minutes until almost all the liquid is absorbed again and the rice looks even creamier.

  9. 9

    Repeat step 8 with another 1 cup broth, stirring for 4 minutes, then add the final 1 cup broth and stir until absorbed and the rice is tender when you bite a grain, about 4 more minutes.

  10. 10

    Slide the cooked mushrooms back into the risotto and stir to combine evenly.

  11. 11

    Remove the pan from heat and stir in the remaining 1 tablespoon butter and the 0.5 cup grated parmesan cheese until fully melted and the risotto looks glossy.

  12. 12

    Taste a small spoonful and add salt and pepper until it tastes well-seasoned to you.

  13. 13

    Divide the risotto between two bowls and serve immediately while hot.

Tools you’ll need

  • 12-inch skillet
  • small pot
  • cutting board
  • knife
  • wooden spoon or risotto spoon
  • rubber spatula
  • plate
  • two bowls
  • microplane or box grater

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.