CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Prasorizo

Tender leeks and arborio rice baked together in a creamy tomato sauce with fresh dill and feta—a classic Greek comfort dish that's naturally vegetarian and ready in under an hour.

Total time
50 min
Servings
4
Calories
385
Protein
11g
Prasorizo
comfortwholesomegreekvegetarianvegetariancreamytenderweeknight

Ingredients

  • 4 medium leeks (white and light green parts), sliced into 1-inch rounds
  • 1.5 cups arborio rice
  • 1 can (14.5 oz) canned crushed tomatoes
  • 2 cups vegetable broth
  • ¾ cup feta cheese, crumbled
  • 3 tbsp fresh dill, chopped (or 1 tsp dried)
  • 3 tbsp olive oil
  • 1 pinch salt and black pepper to taste

Instructions

  1. 1

    Preheat oven to 400°F. Trim leeks and slice into 1-inch rounds, separating layers; rinse thoroughly.

  2. 2

    Heat olive oil in a 9x13-inch baking dish over medium heat, then sauté leeks until edges begin to soften, ~4 minutes.

  3. 3

    Stir in arborio rice and toast for 1 minute until it looks slightly translucent at the edges.

  4. 4

    Pour in crushed tomatoes and vegetable broth; stir well. Season with salt and pepper.

  5. 5

    Cover the baking dish with foil and transfer to the oven. Bake for 35–40 minutes until rice is tender and liquid absorbs.

  6. 6

    Remove from oven and stir in feta cheese and fresh dill. Adjust seasoning and serve hot.

Tools you’ll need

  • 9x13-inch baking dish
  • aluminum foil
  • wooden spoon
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.