CookSnap is coming soon — Join the waitlist →

Portuguese Travesseiro (Almond Pastry Pillow)

A crispy phyllo pastry pillow filled with a sweet almond and egg cream, dusted with cinnamon and powdered sugar. These traditional Portuguese treats are baked until golden and are perfect with coffee or tea.

Total time
25 min
Servings
4
Calories
385
Protein
8g
Portuguese Travesseiro (Almond Pastry Pillow)
elegantindulgentportuguesevegetariancrispycreamyflakybrunch

Ingredients

  • 8 sheets (about 1/4 lb package) phyllo dough sheets
  • 4 tablespoons unsalted butter, melted
  • ½ cup almond paste
  • 2 large egg yolks
  • 2 tablespoons granulated sugar
  • ½ teaspoon ground cinnamon

Instructions

  1. 1

    Set the oven to 375°F and wait until the indicator light or beep tells you it has finished heating, about 10 minutes.

  2. 2

    In a medium bowl, whisk the egg yolks and 2 tablespoons of granulated sugar together using a fork until the mixture is pale yellow and uniform, about 1 minute.

  3. 3

    Add the 0.5 cup of almond paste to the egg mixture and stir using a wooden spoon until no streaks of almond paste remain and the filling looks smooth, about 2 minutes.

  4. 4

    Place one phyllo sheet on a clean, dry cutting board and brush the entire surface lightly with melted butter using a pastry brush until it glistens.

  5. 5

    Lay a second phyllo sheet directly on top of the buttered first sheet, then brush this top sheet with melted butter the same way.

  6. 6

    Spoon half of the almond filling onto the center of the layered phyllo in a thick line, leaving a 2-inch border on all sides.

  7. 7

    Fold the left edge of the phyllo over the filling, then fold the right edge over, overlapping slightly in the center to create a pillow shape.

  8. 8

    Slide the pastry pillow onto a baking sheet, then repeat steps 4–7 with the remaining 4 phyllo sheets and remaining almond filling to make a second pastry.

  9. 9

    Brush the top of each pastry pillow lightly with any remaining melted butter until the surface glistens.

  10. 10

    Place the baking sheet in the preheated 375°F oven and bake until the pastry turns the color of warm honey with darker golden edges, about 12–15 minutes.

  11. 11

    Remove the baking sheet from the oven using oven mitts and let the pastries cool on the sheet for 3 minutes so they firm up slightly.

  12. 12

    Mix the 0.5 teaspoon of ground cinnamon with 2 tablespoons of powdered sugar in a small bowl, stirring with a fork until uniform.

  13. 13

    Dust the top of each pastry pillow generously with the cinnamon-sugar mixture using a fine-mesh sieve or by sprinkling with a spoon.

Tools you’ll need

  • oven
  • medium bowl
  • fork
  • wooden spoon
  • cutting board
  • pastry brush
  • baking sheet
  • oven mitts
  • small bowl
  • fine-mesh sieve

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.