CookSnap is coming soon — Join the waitlist →
Back to recipes

Portuguese Custard Tarts

Crispy, buttery phyllo cups filled with silky egg custard and a hint of cinnamon—a fusion of Portuguese tradition meets simple home baking. Ready in under an hour, no special equipment required.

Total time
45 min
Servings
8
Calories
172
Protein
4g
Portuguese Custard Tarts
indulgentelegantportuguesevegetarianeggscrispycreamyflaky

Ingredients

  • 6 sheets phyllo dough sheets
  • 4 tbsp butter, melted
  • ¾ cup whole milk
  • 3 large eggs
  • 3 tbsp sugar
  • 1 tbsp cornstarch
  • ½ tsp vanilla extract
  • ¼ tsp cinnamon

Instructions

  1. 1

    Preheat oven to 400°F. Line a muffin tin with 8 paper liners.

  2. 2

    Stack phyllo sheets and cut into 16 squares (roughly 4×4 inches each).

  3. 3

    Layer 2 phyllo squares per cup, brushing each lightly with melted butter. Press gently into the liners.

  4. 4

    Bake phyllo cups 6 minutes until pale golden. Remove and let cool slightly.

  5. 5

    Whisk together milk, eggs, sugar, cornstarch, vanilla, and cinnamon in a bowl until smooth.

  6. 6

    Pour custard into each phyllo cup, filling three-quarters full. Don't overfill.

  7. 7

    Bake 15–18 minutes until custard is set at edges but jiggles slightly in the center.

  8. 8

    Cool in the tin 5 minutes, then transfer to a wire rack. Serve warm or at room temperature.

Tools you’ll need

  • muffin tin (12-cup or similar)
  • paper muffin liners
  • small whisk
  • medium bowl
  • pastry brush
  • wire rack

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.