CookSnap is coming soon — Join the waitlist →

20-Min Pastel de Nata (Portuguese Custard Tart)

Buttery, flaky phyllo tarts filled with silky custard and topped with cinnamon. Ready in 20 minutes using store-bought phyllo sheets as a shortcut to the traditional puff pastry.

Total time
20 min
Servings
4
Calories
185
Protein
4g
20-Min Pastel de Nata (Portuguese Custard Tart)
indulgentelegantportuguesevegetarianflakycrispycreamyweeknight

Ingredients

  • 8 sheets phyllo sheets (thawed if frozen)
  • 3 tbsp butter, melted
  • 1 cup whole milk
  • 3 count egg yolks
  • 2.5 tbsp granulated sugar
  • ½ tsp ground cinnamon

Instructions

  1. 1

    Preheat oven to 425°F. Line a muffin tin with 4 phyllo sheets, layering 2 per cup and brushing lightly with melted butter between each.

  2. 2

    Whisk egg yolks with sugar until pale and thick, about 1 minute.

  3. 3

    Heat milk in a small saucepan over medium until steaming (don't boil). Slowly pour into egg mixture while whisking constantly to combine.

  4. 4

    Divide custard evenly among phyllo cups. Bake 12–14 minutes until phyllo edges are golden and custard is just set but still slightly jiggly in the center.

  5. 5

    Remove from oven. Dust generously with cinnamon while still warm. Cool 2 minutes before serving.

Tools you’ll need

  • muffin tin (6-cup or 12-cup)
  • whisk
  • small saucepan
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.