CookSnap is coming soon — Join the waitlist →

Polish Pickle Salad with Potatoes & Kotlet

Sałatka jarzynowa — the iconic Polish vegetable salad with pickles, carrots, and mayonnaise — served alongside boiled potatoes and a crispy ground meat cutlet for a complete weeknight dinner.

Total time
25 min
Servings
4
Calories
475
Protein
18g
Polish Pickle Salad with Potatoes & Kotlet
comfortwholesomepolisheggscreamycrisptenderweeknight

Ingredients

  • 1.5 lb boiling potatoes (waxy, such as Yukon Gold)
  • 3 medium carrots
  • 1 cup diced dill pickle (or sour cucumber), plus 2 tbsp brine
  • ¾ cup mayonnaise
  • 2 pieces ground beef kotlet (pre-made or store-bought frozen)
  • 2 tbsp fresh dill (or parsley), chopped
  • 1 to taste salt and pepper

Instructions

  1. 1

    Bring a large pot of salted water to boil. Add potatoes and carrots; simmer 12–15 minutes until fork-tender.

  2. 2

    Drain potatoes and carrots; cool slightly, then cut potatoes into 1/2-inch cubes and carrots into small dice.

  3. 3

    Heat oil in a skillet over medium-high. Fry kotlets 4–5 minutes per side until edges are golden; set aside.

  4. 4

    In a bowl, combine cubed potatoes, diced carrots, diced pickles, and pickle brine with mayonnaise.

  5. 5

    Fold in 1 tbsp fresh dill; season with salt and pepper to taste.

  6. 6

    Plate salad alongside kotlets and boiled potatoes; garnish with remaining dill and serve warm or at room temperature.

Tools you’ll need

  • large pot
  • colander
  • cutting board
  • chef's knife
  • 12-inch skillet
  • mixing bowl
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.