CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Phyllo Cups with Herbed Ricotta

Delicate, golden phyllo cups filled with creamy ricotta, fresh herbs, and roasted cherry tomatoes. A restaurant-quality appetizer or light dinner ready in 35 minutes.

Total time
35 min
Servings
4
Calories
285
Protein
12g
Crispy Phyllo Cups with Herbed Ricotta
elegantlightitalianvegetariancheesecrispycreamyweeknight

Ingredients

  • 8 sheets phyllo dough sheets
  • 4 tbsp butter, melted
  • 1 cup ricotta cheese
  • ¼ cup parmesan cheese, grated
  • ¼ cup fresh herbs (parsley, dill, and chives), chopped
  • 1 cup cherry tomatoes
  • 2 cloves garlic, minced
  • 1 whole lemon, zested and juiced
  • 1 pinch salt and pepper to taste

Instructions

  1. 1

    Preheat oven to 375°F. Line a baking sheet with parchment paper.

  2. 2

    Stack phyllo sheets, brush each lightly with melted butter, then layer into 4 oven-safe ramekins or muffin tins.

  3. 3

    Bake phyllo cups until golden and crisp, 12–14 minutes. Remove and cool slightly.

  4. 4

    Toss cherry tomatoes with 1 tbsp melted butter, garlic, salt, and pepper. Roast on the baking sheet alongside cups for the last 10 minutes.

  5. 5

    Mix ricotta, parmesan, fresh herbs, lemon zest, and lemon juice in a bowl. Season with salt and pepper.

  6. 6

    Spoon ricotta filling into each phyllo cup, top with roasted tomatoes, and serve warm.

Tools you’ll need

  • baking sheet
  • parchment paper
  • pastry brush
  • 4 oven-safe ramekins or muffin tin
  • mixing bowl
  • microplane zester

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.