Custrd is out on the App Store — Download it free →
Back to recipes

Peruvian Stir-fried Noodles with Beef

A hearty weeknight stir-fry with tender beef, crisp vegetables, and chewy noodles, topped with crispy fries for a satisfying crunch.

Total time
35 min
Servings
4
Calories
550
Protein
32g
Peruvian Stir-fried Noodles with Beef
comfortingheartyPeruvianbeefchewycrispyweeknightstir-fry

Ingredients

  • 1 lb beef sirloin, thinly sliced
  • 8 oz cooked noodles (spaghetti or lo mein)
  • 1 medium red onion, sliced
  • 2 medium tomatoes, cut into wedges
  • 1 medium bell pepper, sliced
  • 2 cups frozen french fries
  • 3 tbsp soy sauce
  • 3 tbsp vegetable oil

Instructions

  1. 1

    Cook the french fries according to package directions until crispy, about 20 minutes in a 425°F oven. Set aside.

  2. 2

    Heat 2 tbsp vegetable oil in a large skillet or wok over high heat until shimmering. Add the 1 lb beef in a single layer and sear without stirring for 2 minutes until browned, then stir-fry for 2 more minutes until just cooked through. Remove beef and set aside.

  3. 3

    Add the remaining 1 tbsp oil to the skillet. Add the 1 sliced onion and 1 sliced bell pepper; stir-fry over high heat for 3 minutes until slightly charred and crisp-tender.

  4. 4

    Add the 2 tomato wedges and stir-fry for 1 minute until they start to soften but still hold their shape.

  5. 5

    Return the beef to the skillet. Add the 8 oz cooked noodles and 3 tbsp soy sauce; toss everything together for 2 minutes until the noodles are heated through and coated.

  6. 6

    Serve the stir-fry topped with the crispy fries and garnish with chopped chives or sliced red chili if you like.

  7. 7

    Enjoy immediately while hot.

Tools you’ll need

  • large skillet or wok
  • baking sheet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.