Perfect Latte
Silky espresso and steamed milk with a touch of sweetness. Takes 5 minutes and tastes like a café.
- Total time
- 5 min
- Servings
- 1
- Calories
- 140
- Protein
- 8g
cozysimpleitalianvegetariancreamysilkyweeknightmorning
Ingredients
- 2 shots espresso
- 8 oz whole milk
- ½ tsp honey or vanilla syrup
Instructions
- 1
Pull two shots of espresso into a cup.
- 2
Steam milk until it reaches 150–155°F and small bubbles cover the surface.
- 3
Pour steamed milk into the espresso, holding back the foam with a spoon.
- 4
Top with a thin layer of milk foam and a drizzle of honey if desired.
Tools you’ll need
- espresso machine
- milk pitcher
- thermometer
- cup
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
