CookSnap is coming soon — Join the waitlist →
Back to recipes

Pepper Jack Grilled Cheese

Melty pepper jack cheese between buttered bread, toasted until golden and crispy. Serve with fries, pickled jalapeños, and a side salad for a classic diner lunch.

Total time
10 min
Servings
2
Calories
385
Protein
14g
Pepper Jack Grilled Cheese
comfortcasualamericanvegetariancrispymeltyweeknightlunch

Ingredients

  • 4 slices bread
  • 4 slices pepper jack cheese
  • 2 tbsp butter

Instructions

  1. 1

    Butter one side of each bread slice generously, using about 1/2 tbsp per slice.

  2. 2

    Heat a skillet over medium heat until a water droplet sizzles on contact, ~1 minute.

  3. 3

    Place one slice butter-side down in the skillet, top with 2 cheese slices, then the second slice butter-side up.

  4. 4

    Toast 2–3 minutes until the bottom is golden brown and crispy.

  5. 5

    Flip and toast the other side 1–2 minutes until golden and cheese melts completely.

  6. 6

    Slice diagonally and serve immediately with fries, pickled jalapeños, and salad.

Tools you’ll need

  • 8-inch skillet
  • butter knife
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.