Custrd is out on the App Store — Download it free →
Back to recipes

Pecel Lele

Crispy fried catfish served with a spicy peanut sauce, fresh vegetables, and rice. A beloved Indonesian street food dish that's surprisingly simple to make at home.

Total time
40 min
Servings
4
Calories
650
Protein
35g
Pecel Lele
comfort foodIndonesiangluten-freefishcrispycreamyweeknight dinnermain course

Ingredients

  • 4 fillets catfish fillets
  • 1 whole lime
  • ½ cup peanut butter
  • 2 tbsp sweet soy sauce
  • 2 tbsp chili paste
  • 1 cup green beans
  • 2 cups rice
  • ½ cup vegetable oil

Instructions

  1. 1

    Cook the 2 cups rice according to package directions; keep warm.

  2. 2

    Blanch the 1 cup green beans in boiling water for 2 minutes until bright green and crisp-tender; drain and set aside.

  3. 3

    Rub the 4 catfish fillets with juice from the 1 lime and a pinch of salt; let sit for 5 minutes.

  4. 4

    Heat 0.5 cup vegetable oil in a large skillet over medium-high. Fry the catfish in batches until golden and crispy, about 4 minutes per side; drain on paper towels.

  5. 5

    In a bowl, mix 0.5 cup peanut butter, 2 tbsp sweet soy sauce, 2 tbsp chili paste, and 3 tbsp hot water until smooth; add more water for a pourable sauce.

  6. 6

    Serve the catfish with rice, green beans, and the peanut sauce; garnish with crispy fried shallots if you have them.

Tools you’ll need

  • Large skillet
  • Pot for rice
  • Small pot for blanching
  • Mixing bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.