CookSnap is coming soon — Join the waitlist →
Back to recipes

Pear Frangipane Tart

A classic French almond cream tart with caramelized pears on a buttery pastry base. Elegant enough for dinner guests, simple enough for a weeknight dessert.

Total time
50 min
Servings
8
Calories
342
Protein
6g
Pear Frangipane Tart
elegantindulgentfrenchvegetarianvegetariancreamyflakytender

Ingredients

  • 1 cup all-purpose flour
  • 10 tbsp cold butter, divided
  • ¼ tsp salt
  • ¾ cup almond flour
  • ½ cup granulated sugar
  • 1 large egg
  • 3 whole pears, firm

Instructions

  1. 1

    Mix flour and salt. Cut 6 tbsp cold butter into pea-sized pieces and rub into flour until breadcrumb texture forms.

  2. 2

    Add 3 tbsp ice water a little at a time, tossing until the dough just comes together. Wrap and chill 15 minutes.

  3. 3

    Preheat oven to 375°F. Roll dough into a 10-inch circle and press into a 9-inch tart pan with removable bottom.

  4. 4

    Beat remaining 4 tbsp softened butter with sugar until pale, about 2 minutes. Fold in almond flour and egg until smooth.

  5. 5

    Spread frangipane evenly over dough base. Peel, halve, and core pears; arrange cut-side down in a spiral on top.

  6. 6

    Bake until pastry is golden and frangipane springs back when lightly touched, 30–35 minutes.

  7. 7

    Cool in pan 10 minutes, then transfer to a wire rack. Serve at room temperature or slightly warm.

Tools you’ll need

  • 9-inch tart pan with removable bottom
  • rolling pin
  • mixing bowl
  • electric mixer or whisk
  • rubber spatula
  • chef's knife
  • wire rack
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.