CookSnap is coming soon — Join the waitlist →
Back to recipes

Canelés de Bordeaux

Caramelized French pastries with crispy caramelized exteriors and creamy vanilla-rum interiors. These elegant molds create a showstopping dessert that looks far more complicated than it is.

Total time
90 min
Servings
8
Calories
185
Protein
3g
Canelés de Bordeaux
elegantindulgentfrenchvegetariancrispycreamycaramelizeddate-night

Ingredients

  • 1 cup whole milk
  • 1 whole vanilla bean, split lengthwise
  • ½ cup all-purpose flour
  • ¾ cup granulated sugar
  • 2 whole eggs
  • 3 tbsp butter, melted
  • 2 tbsp dark rum

Instructions

  1. 1

    Heat milk with vanilla bean in a small saucepan over medium until steaming, ~4 minutes. Remove from heat and let cool 15 minutes.

  2. 2

    Strain out vanilla bean, scraping seeds back into milk. Discard the pod.

  3. 3

    Whisk flour and sugar together in a large bowl until no lumps remain.

  4. 4

    Add eggs to flour mixture and whisk until smooth, ~1 minute.

  5. 5

    Pour cooled milk into egg mixture while whisking constantly until fully combined.

  6. 6

    Stir in melted butter and rum until fully incorporated.

  7. 7

    Strain batter through a fine sieve into a clean bowl to remove any lumps. Cover and chill at least 2 hours, or overnight.

  8. 8

    Preheat oven to 450°F. Brush canelé molds generously with melted beeswax or butter inside all crevices.

  9. 9

    Place molds on a baking sheet. Pour chilled batter into molds until just below the rim.

  10. 10

    Bake at 450°F for 15 minutes until edges are dark brown and caramelized.

  11. 11

    Reduce heat to 350°F and bake 30 minutes more until centers are just set but centers still jiggle slightly.

  12. 12

    Remove from oven and cool in molds 5 minutes, then invert onto a wire rack to cool completely.

Tools you’ll need

  • canelé molds (8 copper or silicone)
  • small saucepan
  • large mixing bowl
  • whisk
  • fine sieve
  • baking sheet
  • oven thermometer
  • pastry brush
  • wire cooling rack

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.