CookSnap is coming soon — Join the waitlist →

Saint-Honoré Cake

A showstopping French dessert with crispy choux buns arranged on a pastry base, bound together with caramel and topped with whipped cream. Impressive but achievable with store-bought puff pastry.

Total time
75 min
Servings
8
Calories
385
Protein
6g
Saint-Honoré Cake
elegantindulgentfrenchvegetariancrispycreamyfluffydate-night

Ingredients

  • 1 sheet (9×12 inches) puff pastry (thawed)
  • ½ cup butter
  • ½ cup water
  • 1 cup all-purpose flour
  • 4 large, divided eggs
  • 1 cup sugar
  • 1 cup heavy cream (cold)

Instructions

  1. 1

    Preheat oven to 400°F. Line two baking sheets with parchment paper.

  2. 2

    Place puff pastry on one sheet. Prick all over with a fork to prevent puffing.

  3. 3

    Combine butter and water in a saucepan. Heat over medium until butter melts and mixture boils, ~2 minutes.

  4. 4

    Remove from heat. Stir in flour until a thick dough forms, stirring constantly for 1 minute.

  5. 5

    Cool dough 3 minutes, then beat in 3 eggs one at a time, stirring until each is fully incorporated.

  6. 6

    Transfer choux to a piping bag fitted with a 0.5-inch tip. Pipe 16–20 small mounds onto the second sheet, spacing 1 inch apart.

  7. 7

    Beat remaining egg. Brush each choux bun lightly with beaten egg.

  8. 8

    Bake both sheets at 400°F for 20 minutes until puff pastry is golden and choux are light brown.

  9. 9

    Remove from oven and cool both sheets on a wire rack for 10 minutes.

  10. 10

    In a heavy saucepan, melt 0.5 cup sugar over medium heat, stirring constantly, until amber-colored, ~6 minutes. Do not stir after sugar liquefies—just swirl the pan.

  11. 11

    Working quickly, dip base of each choux bun into hot caramel. Arrange in a circle atop the puff pastry base, pressing lightly to adhere.

  12. 12

    Drizzle remaining caramel over the choux buns and pastry base, letting it cool and harden, ~15 minutes.

  13. 13

    Whip cold cream with 1 tablespoon sugar until stiff peaks form, ~2 minutes.

  14. 14

    Transfer cake to a serving plate. Spoon whipped cream into center or dollop on top. Serve immediately.

Tools you’ll need

  • two baking sheets
  • parchment paper
  • fork
  • medium saucepan
  • wooden spoon
  • piping bag
  • 0.5-inch pastry tip
  • heavy saucepan
  • wire rack
  • electric mixer or whisk
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.