CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Patacones con Hogao

Twice-fried green plantain patties served with Colombian tomato-onion sauce. Crispy, savory, and utterly addictive—a street-food classic that takes 20 minutes.

Total time
20 min
Servings
2
Calories
320
Protein
2g
Patacones con Hogao
casualcomfortcolombianvegetarianvegetariancrispytenderweeknight

Ingredients

  • 2 medium green plantains (unripe)
  • 1 cup vegetable oil
  • 1 medium onion
  • 2 medium tomatoes
  • 2 whole garlic cloves
  • ½ tsp salt
  • ¼ tsp black pepper

Instructions

  1. 1

    Dice the onion and tomatoes into small pieces. Mince the garlic.

  2. 2

    Heat 1 tbsp oil in a skillet over medium. Add onion, cook until soft, ~3 minutes.

  3. 3

    Add garlic, stir 30 seconds. Add tomatoes, salt, and pepper. Simmer 5 minutes until jammy.

  4. 4

    Peel the plantains. Slice crosswise into 1/2-inch-thick rounds.

  5. 5

    Heat oil in a deep skillet to 350°F (test: a cube of bread browns in 60 seconds).

  6. 6

    Fry plantain rounds in batches 2–3 minutes per side until light golden. Transfer to a plate.

  7. 7

    Once cool enough to handle, press each round flat with a tostonera or the bottom of a glass.

  8. 8

    Return pressed patacones to oil, fry 90 seconds per side until deep golden and crispy.

  9. 9

    Drain patacones on paper towels. Top with warm hogao and serve immediately.

Tools you’ll need

  • cutting board
  • knife
  • deep skillet or large saucepan
  • thermometer (optional but recommended)
  • tostonera or flat-bottomed glass
  • slotted spoon or spider strainer
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.