CookSnap is coming soon — Join the waitlist →
Back to recipes

Pancit Guisado

A savory Filipino stir-fried noodle dish with tender chicken, shrimp, and vegetables tossed in a light soy-based sauce. Ready in under 25 minutes, cooked entirely in one pan.

Total time
25 min
Servings
4
Calories
520
Protein
38g
Pancit Guisado
comfortsatisfyingfilipinochickenshrimptenderchewyweeknight

Ingredients

  • 1 lb fresh egg noodles or wheat noodles
  • ½ lb chicken breast, boneless and skinless
  • ½ lb large shrimp, peeled and deveined
  • 2 cups cabbage, shredded
  • 3 tablespoons soy sauce
  • 3 cloves garlic cloves, minced

Instructions

  1. 1

    Cut the chicken breast into 1/4-inch-thick strips by slicing across the width of the meat, perpendicular to the length. This makes the chicken cook faster.

  2. 2

    Mince the garlic cloves until the pieces are smaller than a grain of rice — about the size of pencil-tip dots.

  3. 3

    Bring a large pot of water to a boil, then add the noodles and cook, stirring occasionally, until soft enough to bite through but still slightly firm, about 4–5 minutes.

  4. 4

    Drain the noodles in a colander and set aside.

  5. 5

    Pour 2 tablespoons of oil into a 14-inch wok or large skillet and set the heat to medium-high until the oil shimmers and slides quickly when you tilt the pan, about 90 seconds.

  6. 6

    Add the minced garlic to the hot oil and stir constantly for 30 seconds until the kitchen smells strongly fragrant.

  7. 7

    Add the chicken strips to the pan and stir continuously, breaking up any pieces, until the surface is no longer pink, about 4–5 minutes.

  8. 8

    Add the shrimp to the pan and stir constantly until they turn opaque and curl slightly, about 2–3 minutes.

  9. 9

    Pour the cooked noodles into the pan and toss everything together with two wooden spoons or spatulas until combined, about 1 minute.

  10. 10

    Add the shredded cabbage to the pan and stir continuously until it begins to soften and wilt, about 2 minutes.

  11. 11

    Pour in 3 tablespoons of soy sauce and stir everything together for 1–2 minutes until the noodles are evenly coated and the vegetables are tender.

Tools you’ll need

  • large pot
  • colander
  • 14-inch wok or large skillet
  • wooden spoon or spatula
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.