CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Pan-Seared Beef Shank with Creamy Gravy

Tender beef shank seared and finished with a rich, savory gravy, served over creamy mashed potatoes with broccoli and fresh avocado. A weeknight take on French braise that skips the long simmer.

Total time
28 min
Servings
2
Calories
625
Protein
48g
Pan-Seared Beef Shank with Creamy Gravy
comfortheartyfrenchbeeftendercreamyweeknightdinner

Ingredients

  • 2 pieces beef shanks (cross-cut, about 1.5 inches thick)
  • 2 tbsp butter
  • 1 cup beef broth
  • ½ cup heavy cream
  • 1 tbsp Dijon mustard
  • 2 sprigs fresh thyme
  • 2 cups mashed potatoes (prepared or instant)
  • 2 cups broccoli florets (steamed or roasted)
  • 1 whole avocado, sliced

Instructions

  1. 1

    Pat beef shanks dry with paper towels. Season both sides generously with salt and black pepper.

  2. 2

    Heat butter in a large skillet over medium-high until foaming. Sear shanks 3 minutes per side until golden brown. Transfer to a plate.

  3. 3

    Pour broth into the skillet, scraping up browned bits. Add mustard and thyme sprigs. Return shanks and simmer 12 minutes until fork-tender.

  4. 4

    Remove shanks from pan. Stir cream into the broth over medium heat for 1 minute until sauce thickens slightly. Taste and season with salt and pepper.

  5. 5

    Divide mashed potatoes and broccoli between two plates. Top with a beef shank, pour gravy over, and arrange avocado slices on the side.

Tools you’ll need

  • 12-inch skillet or large sauté pan
  • paper towels
  • wooden spoon or spatula
  • tongs
  • two dinner plates

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.