Custrd is out on the App Store — Download it free →
Back to recipes

Pan-Seared Beef Liver with Crispy Onions

Thin-sliced beef liver seared until just cooked through, layered with caramelized onions and a bright splash of balsamic. Ready in 15 minutes—restaurant-quality, weeknight-easy.

Total time
15 min
Servings
2
Calories
320
Protein
28g
Pan-Seared Beef Liver with Crispy Onions
elegantquickitalianbeeftendercrispyweeknightmain-dish

Ingredients

  • ¾ lb beef liver, thinly sliced (about 1/4 inch)
  • 2 medium yellow onions, sliced into thin rings
  • 4 tbsp olive oil
  • 2 tbsp balsamic vinegar
  • 1 tbsp fresh thyme leaves or Italian parsley, chopped
  • 1 pinch salt and black pepper

Instructions

  1. 1

    Heat 2 tbsp olive oil in a large skillet over medium-high until shimmering, about 90 seconds.

  2. 2

    Add onion rings and cook, stirring occasionally, until golden and caramelized, 6–8 minutes. Season lightly with salt and pepper. Transfer to a plate.

  3. 3

    Pat liver dry with paper towels. Season both sides generously with salt and black pepper.

  4. 4

    Add remaining 2 tbsp oil to the skillet. Once smoking, lay liver slices flat and sear without moving, 90 seconds per side. Liver should be pink inside.

  5. 5

    Return onions to the skillet and drizzle everything with balsamic vinegar. Toss gently for 30 seconds until glossy.

  6. 6

    Plate immediately and scatter fresh thyme or parsley on top. Serve hot.

Tools you’ll need

  • 12-inch skillet (cast iron or stainless steel)
  • paper towels
  • tongs or spatula
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.