CookSnap is coming soon — Join the waitlist →
Back to recipes

Lemon Butter Beef Piccata

Thin-pounded beef cutlets seared golden, finished with a bright lemon-caper pan sauce. Restaurant-quality weeknight dinner in 20 minutes.

Total time
20 min
Servings
2
Calories
380
Protein
32g
Lemon Butter Beef Piccata
elegantquickitalianbeeftendercrispyweeknightdate-night

Ingredients

  • 4 pieces beef thin-cut steaks or cutlets (about 4 oz each)
  • ¼ cup all-purpose flour
  • 1 whole lemon (juiced + zested)
  • 3 tbsp capers, drained
  • 3 tbsp butter
  • ½ cup dry white wine or chicken stock

Instructions

  1. 1

    Place each beef cutlet between plastic wrap and pound to 1/4-inch thickness with a meat mallet.

  2. 2

    Season beef with salt and pepper. Dredge lightly in flour, shaking off excess.

  3. 3

    Heat 1 tbsp butter and 1 tbsp olive oil in a 12-inch skillet over medium-high until foaming.

  4. 4

    Sear beef 90 seconds per side without moving until golden. Transfer to a plate.

  5. 5

    Pour wine into the pan, scraping up browned bits. Add lemon juice, capers, and remaining 2 tbsp butter.

  6. 6

    Simmer 1 minute until sauce thickens slightly. Return beef to pan, coat with sauce, and serve immediately.

Tools you’ll need

  • 12-inch skillet
  • meat mallet
  • plastic wrap
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.