CookSnap is coming soon — Join the waitlist →

Veal Piccata

Tender veal cutlets dredged in flour, pan-seared golden, and finished with a bright lemon-caper sauce. Classic Italian elegance in under 30 minutes.

Total time
25 min
Servings
4
Calories
385
Protein
38g
Veal Piccata
elegantfreshitalianbeeftendercrispyweeknightdate-night

Ingredients

  • 1 lb veal cutlets
  • ½ cup all-purpose flour
  • 1.5 medium lemon (juiced + zested)
  • ⅓ cup capers, drained
  • 3 tbsp butter
  • 2 tbsp olive oil
  • 1 to taste salt and pepper
  • 2 tbsp fresh parsley, chopped

Instructions

  1. 1

    Place each veal cutlet between plastic wrap and pound thin (1/4-inch) with a meat mallet.

  2. 2

    Spread flour on a shallow plate. Season veal with salt and pepper, then dredge both sides in flour, tapping off excess.

  3. 3

    Heat olive oil in a 12-inch skillet over medium-high heat until it shimmers, about 90 seconds.

  4. 4

    Working in batches if needed, sear veal 90 seconds per side without moving. Veal should be golden; don't overcrowd the pan.

  5. 5

    Transfer seared veal to a plate. Reduce heat to medium.

  6. 6

    Add lemon juice, capers, and lemon zest to the skillet. Swirl in butter until melted and sauce coats the back of a spoon, about 1 minute.

  7. 7

    Return veal to the skillet and turn to coat in sauce. Cook 30 seconds per side.

  8. 8

    Divide veal among plates, spoon sauce and capers over top, and sprinkle with fresh parsley. Serve immediately.

Tools you’ll need

  • meat mallet
  • plastic wrap
  • shallow plate
  • 12-inch skillet
  • tongs or fish spatula
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.