CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Pan-Fried Kaszanka

Crispy-edged Polish blood sausage sliced and pan-fried until golden, served with mustard and dark rye bread. A quick, authentic weeknight dinner that tastes far more impressive than the minimal effort required.

Total time
15 min
Servings
2
Calories
520
Protein
24g
Pan-Fried Kaszanka
comfortrusticpolishporkcrispytenderweeknightmain-dish

Ingredients

  • 1 lb kaszanka (Polish blood sausage)
  • 1 tablespoon olive oil
  • 1 medium onion, yellow
  • 3 tablespoon whole grain mustard
  • 4 slices dark rye bread
  • 1 to taste salt and pepper

Instructions

  1. 1

    Pat the kaszanka dry with paper towels, using firm pressure to remove surface moisture so it browns well instead of steaming.

  2. 2

    Place the kaszanka on a cutting board and slice it into rounds about 1/3-inch thick, cutting straight down through the sausage like you're slicing bread.

  3. 3

    Cut the onion in half from root to tip, then lay each half flat and slice crosswise into thin half-moons about 1/8-inch thick.

  4. 4

    Heat 1 tablespoon olive oil in a 12-inch skillet over medium-high heat until it shimmers and slides quickly when you tilt the pan, about 90 seconds.

  5. 5

    Add the kaszanka slices in a single layer without overlapping and cook undisturbed for 3 minutes, until the bottom surfaces turn golden brown and crispy at the edges.

  6. 6

    Flip each slice over with tongs and cook for another 2 minutes until the second side is also golden brown.

  7. 7

    Push the cooked kaszanka to the sides of the skillet, creating an empty space in the center where the heat is hottest.

  8. 8

    Add the sliced onion to the center and cook, stirring once every 30 seconds, for 4 minutes until the onion is soft and golden at the edges.

  9. 9

    Stir the kaszanka and onion together in the skillet for 30 seconds to combine, then season with salt and pepper to taste.

  10. 10

    Divide the kaszanka and onions between two plates and place 2 slices of rye bread on each plate.

  11. 11

    Spread 1.5 tablespoons of mustard on each plate next to the sausage so you can dip each bite as you eat.

Tools you’ll need

  • 12-inch skillet with lid
  • cutting board
  • sharp kitchen knife
  • paper towels
  • tongs
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.