One Minute Oatmeal
Creamy, customizable oatmeal ready in 60 seconds flat. Choose your toppings and make it your own.
- Total time
- 3 min
- Servings
- 1
- Calories
- 238
- Protein
- 7g

quicksimplevegetarianvegetariancreamysoftBreakfastweeknight
Ingredients
- ½ cup rolled oats
- ¾ cup milk (dairy or non-dairy)
- 1 tbsp honey or maple syrup
- ½ medium banana, sliced
- ⅛ tsp salt
Instructions
- 1
Combine oats, milk, honey, and salt in a microwave-safe bowl.
- 2
Microwave on high for 60 seconds, stirring halfway through.
- 3
Stir vigorously until the mixture is smooth and creamy.
- 4
Top with banana slices. Serve immediately.
Tools you’ll need
- microwave-safe bowl
- spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



