CookSnap is coming soon — Join the waitlist →

10-Min Neua Pad Prik — Thai Beef & Chili

Thin-sliced beef and fresh chilis seared hot and fast in a Thai-style stir-fry with soy, garlic, and a touch of fish sauce. Ready in under 10 minutes, salty-spicy-bright, and utterly addictive.

Total time
10 min
Servings
2
Calories
385
Protein
42g
10-Min Neua Pad Prik — Thai Beef & Chili
quickboldthaibeeftendercrispyweeknightstir-fry

Ingredients

  • ¾ lb beef sirloin or ribeye
  • 3 whole fresh Thai bird chilis (or jalapeños)
  • 4 cloves garlic
  • 2 tbsp soy sauce
  • ½ tbsp fish sauce
  • 2 tbsp neutral cooking oil

Instructions

  1. 1

    Slice beef thinly against the grain, about 1/8-inch thick. Slice chilis lengthwise; mince garlic.

  2. 2

    Heat oil in a 12-inch skillet over high heat until it shimmers and wisps of smoke appear, ~90 seconds.

  3. 3

    Add beef in a single layer and sear without stirring until edges brown, ~60 seconds. Stir and cook another 60 seconds.

  4. 4

    Push beef to the side. Add garlic to the empty space, cook 30 seconds until fragrant, then toss together.

  5. 5

    Add chilis, soy sauce, and fish sauce. Toss constantly for 60 seconds until chilis soften and sauce coats the beef.

  6. 6

    Serve immediately in a bowl or over rice.

Tools you’ll need

  • 12-inch skillet or wok
  • cutting board
  • sharp knife
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.