CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Nasi Goreng Pete with Shrimp & Egg

Fragrant Indonesian fried rice loaded with stink beans, shrimp, and a runny egg on top. Bold, savory, and deeply satisfying—the stink beans add a pungent, earthy depth that makes this dish unforgettable.

Total time
35 min
Servings
4
Calories
485
Protein
18g
Nasi Goreng Pete with Shrimp & Egg
satisfyingboldindonesianshrimpeggscrispytenderweeknight

Ingredients

  • 3 cups cooked white rice, cooled and broken into grains
  • 1.5 cups stink beans (pete), fresh or frozen, cut into 1-inch pieces
  • 8 oz medium shrimp, peeled and deveined
  • 4 whole eggs
  • 4 cloves garlic cloves, minced
  • 3 whole shallots, thinly sliced
  • 2 whole red chilies (bird's eye or serrano), minced
  • 3 tbsp kecap manis (Indonesian sweet soy sauce)
  • 1 tbsp fish sauce
  • 1 whole lime
  • 3 tbsp vegetable oil
  • 1 pinch salt and black pepper to taste
  • 2 stalks scallions, chopped (optional garnish)

Instructions

  1. 1

    If using fresh stink beans, blanch in boiling water 3 minutes until tender. Drain and set aside.

  2. 2

    Pat shrimp dry with paper towels. Season with a pinch of salt.

  3. 3

    Have all ingredients prepped and within reach—fried rice cooks fast once you begin.

  4. 4

    Heat 1.5 tbsp oil in a large skillet or wok over medium-high until shimmering, ~90 seconds.

  5. 5

    Add shrimp and sear 90 seconds per side without moving until opaque throughout. Transfer to a plate.

  6. 6

    Add remaining 1.5 tbsp oil to the pan. Stir in garlic, shallots, and chili for 60 seconds until fragrant.

  7. 7

    Add stink beans and stir-fry 2 minutes, breaking up any clumps.

  8. 8

    Pour in rice, breaking up clumps with the back of a spoon. Stir constantly 3 minutes until heated through.

  9. 9

    Drizzle kecap manis and fish sauce over the rice. Toss well and cook 90 seconds more.

  10. 10

    Return shrimp to the pan and fold gently into the rice. Remove from heat and squeeze lime juice over top.

  11. 11

    Wipe the skillet clean. Add remaining oil over medium-high heat until shimmering, ~90 seconds.

  12. 12

    Crack eggs into the pan and fry until whites set but yolks still jiggle, ~3 minutes.

  13. 13

    Divide fried rice among bowls. Top each with a fried egg. Garnish with scallions if desired. Serve immediately.

Tools you’ll need

  • large skillet or 14-inch wok
  • paper towels
  • chef's knife
  • cutting board
  • spoon or spatula
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.