CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Mushroom Hummus

Creamy tahini-chickpea base topped with sautéed mushrooms and garlic. A Lebanese-inspired dip that's rich, earthy, and ready in 10 minutes.

Total time
10 min
Servings
6
Calories
185
Protein
7g
Mushroom Hummus
casuallebanesevegetarianveganchickpeascreamysmoothAppetizer

Ingredients

  • 1.5 cans (15 oz each) canned chickpeas, drained and rinsed
  • 3 tbsp tahini
  • 8 oz fresh mushrooms, sliced
  • 3 cloves garlic cloves, minced
  • 1 whole lemon (juiced)

Instructions

  1. 1

    Combine chickpeas, tahini, 2 tbsp lemon juice, 2 tbsp water, and salt in a food processor.

  2. 2

    Blend until completely smooth and creamy, ~2 minutes. Add more water if too thick.

  3. 3

    Heat 2 tbsp olive oil in a skillet over medium-high heat until shimmering.

  4. 4

    Add mushrooms and garlic. Cook, stirring occasionally, until golden brown, ~5 minutes.

  5. 5

    Stir in remaining lemon juice and season with salt and pepper to taste.

  6. 6

    Spread hummus on a serving plate or bowl. Top with warm mushroom mixture.

  7. 7

    Drizzle with extra olive oil and serve warm or at room temperature.

Tools you’ll need

  • food processor
  • 12-inch skillet
  • measuring spoons
  • cutting board
  • chef's knife
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.