CookSnap is coming soon — Join the waitlist →

20-Min Mole Chicken Empanada Skillet

Crispy wonton wrappers stuffed with shredded chicken and jarred mole negro, baked until golden. Rich, spiced, and ready in 20 minutes—no classical slow-simmering required.

Total time
20 min
Servings
2
Calories
385
Protein
18g
20-Min Mole Chicken Empanada Skillet
comfortsatisfyingmexicanchickencrispytendermeltyweeknight

Ingredients

  • 1.5 cups rotisserie chicken, shredded
  • ¾ cup jarred mole negro sauce
  • 12 count wonton wrappers
  • 2 tbsp whole milk
  • ½ cup sharp cheddar, shredded
  • 2 tbsp olive oil

Instructions

  1. 1

    Stir shredded chicken, mole sauce, and cheese in a bowl until fully combined.

  2. 2

    Place a wonton wrapper flat. Brush edges lightly with milk using your finger.

  3. 3

    Spoon 1 tbsp filling into the center. Fold into a triangle, then bring corners together and press to seal.

  4. 4

    Repeat with remaining wrappers. Brush all empanadas with olive oil on both sides.

  5. 5

    Arrange on a sheet pan. Bake at 400°F until golden and crispy, about 10–12 minutes.

  6. 6

    Cool 2 minutes. Serve hot with extra mole sauce on the side for dipping.

Tools you’ll need

  • small bowl
  • sheet pan
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.