CookSnap is coming soon — Join the waitlist →
Back to recipes

25-Min Mole Chichilo Beef Bowl

A TikTok-easy take on Oaxaca's darkest mole, built on jarred mole chichilo and quick-seared beef. Serve over rice with charred peppers and onions for a weeknight dinner that tastes like you slow-cooked it.

Total time
25 min
Servings
2
Calories
585
Protein
38g
25-Min Mole Chichilo Beef Bowl
comfortboldmexicanbeeftendercrispyweeknightdinner

Ingredients

  • ¾ lb beef sirloin or flank steak, thinly sliced
  • 1.25 cups jarred mole chichilo sauce
  • 1 whole red onion, halved lengthwise
  • 1 whole poblano or red bell pepper, halved
  • 1.5 cups cooked white or brown rice
  • 1 whole lime
  • ¼ cup fresh cilantro, chopped

Instructions

  1. 1

    Pat beef dry with paper towels. Season generously with salt and black pepper.

  2. 2

    Heat 2 tbsp olive oil in a large skillet over medium-high until shimmering, about 90 seconds.

  3. 3

    Sear beef in a single layer 90 seconds per side without stirring. Edges should turn brown; center stays rare.

  4. 4

    Push beef to the side. Add onion and pepper halves cut-side down; sear 3 minutes until charred and tender.

  5. 5

    Pour in mole chichilo sauce, stir gently to coat, and simmer 3 minutes until glossy and fragrant.

  6. 6

    Divide rice into bowls, top with beef, charred vegetables, and sauce. Squeeze lime over and garnish with cilantro.

Tools you’ll need

  • large skillet (12 inches)
  • paper towels
  • wooden spoon or silicone spatula
  • bowls for serving

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.