Custrd is out on the App Store — Download it free →
Back to recipes

Mini Loaded Baked Potatoes

Bite-sized baked potatoes topped with creamy sour cream and fresh chives. Perfect for parties or a fun side dish.

Total time
45 min
Servings
4
Calories
220
Protein
4g
Mini Loaded Baked Potatoes
comfort foodpartyAmericanvegetariangluten-freevegetariancrispycreamy

Ingredients

  • 1.5 pounds baby potatoes
  • 2 tablespoons olive oil
  • 1 teaspoon salt
  • ½ teaspoon black pepper
  • ½ cup sour cream
  • 2 tablespoons fresh chives

Instructions

  1. 1

    Preheat oven to 400°F. Scrub the 1.5 lbs baby potatoes and pat dry.

  2. 2

    Toss potatoes with 2 tbsp olive oil, 1 tsp salt, and 1/2 tsp black pepper in a bowl.

  3. 3

    Arrange potatoes on a baking sheet in a single layer. Roast until tender and skins are crisp, about 25-30 minutes.

  4. 4

    Let potatoes cool slightly, then gently flatten each with a fork or the bottom of a glass until they crack open.

  5. 5

    Return to oven and bake 10 more minutes until edges are golden and crispy.

  6. 6

    Top each potato with a small dollop of sour cream (about 1/2 cup total) and sprinkle with 2 tbsp chopped chives. Serve warm.

Tools you’ll need

  • baking sheet
  • mixing bowl
  • fork or glass

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.