Melty Bean & Cheese Molletes
Split French bread, top with warm refried beans and melted Monterey Jack, then broil until bubbly and golden. A 10-minute breakfast that tastes like a Mexican bakery.
- Total time
- 10 min
- Servings
- 2
- Calories
- 385
- Protein
- 16g
quickcomfortmexicanvegetariancrispymeltyweeknightbreakfast
Ingredients
- 1 loaf (about 10 oz) French bread
- 1 cup refried beans
- 1.5 cups Monterey Jack cheese, shredded
Instructions
- 1
Slice the loaf in half lengthwise, then place both halves cut-side up on a broiler pan.
- 2
Spread refried beans evenly over both halves, using about 1/2 cup per half.
- 3
Top each half with shredded Monterey Jack cheese, pressing gently to stick.
- 4
Broil 3-4 inches from heat until cheese melts and bubbles, about 3-4 minutes.
- 5
Cool 1 minute, then slice each half into 2-3 pieces and serve immediately.
Tools you’ll need
- broiler pan
- bread knife
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
