CookSnap is coming soon — Join the waitlist →
Back to recipes

Mediterranean Chicken & Egg Skillet

Diced chicken, kale, corn, and tomatoes cooked together in one skillet, then finished with a fried egg for a protein-packed breakfast or brunch. Ready in 15 minutes—no sides needed.

Total time
15 min
Servings
2
Calories
342
Protein
38g
Mediterranean Chicken & Egg Skillet
freshwholesomemediterraneanchickeneggstendercrispyweeknight

Ingredients

  • 8 oz diced chicken breast
  • 2 tbsp olive oil
  • 2 cups fresh kale, chopped
  • 1 cup tomatoes (fresh or canned), diced
  • ¾ cup corn (fresh or frozen)
  • 2 whole eggs

Instructions

  1. 1

    Heat oil in a 10-inch skillet over medium-high until shimmering, about 60 seconds.

  2. 2

    Add diced chicken and cook, stirring occasionally, until no pink remains, 5–6 minutes.

  3. 3

    Add kale, tomatoes, and corn; stir and cook until kale wilts and tomato releases juices, 3 minutes.

  4. 4

    Create two small wells in the veggie mixture and crack one egg into each.

  5. 5

    Cover with a lid (or foil) and cook until egg whites are set but yolks still jiggle, 2–3 minutes.

  6. 6

    Season with salt and pepper. Serve straight from the skillet.

Tools you’ll need

  • 10-inch skillet with a lid
  • wooden spoon or silicone spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.