CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Halloumi & Egg Tomato Skillet

A Mediterranean one-pan breakfast with wilted spinach, a tangle of sweet tomatoes, fried halloumi, and eggs that stay runny in the center. Ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
385
Protein
24g
Crispy Halloumi & Egg Tomato Skillet
freshlightmediterraneanvegetarianeggscheesecrispyrunny

Ingredients

  • 8 oz halloumi cheese
  • 2 cups (packed) fresh spinach
  • 1.5 cups cherry tomatoes, halved
  • 4 whole eggs
  • ¼ medium red onion, sliced thin
  • 1 tbsp (chopped) fresh oregano (or 0.5 tsp dried)
  • 2 tbsp feta cheese, crumbled (optional)

Instructions

  1. 1

    Pat halloumi dry, then slice into 0.5-inch-thick planks.

  2. 2

    Heat olive oil in a 10-inch skillet over medium-high until shimmering.

  3. 3

    Fry halloumi until golden and crispy on both sides, ~2 minutes each. Transfer to a plate.

  4. 4

    Add red onion to the same skillet, sauté until soft, ~2 minutes.

  5. 5

    Add cherry tomatoes and oregano, cook until tomatoes start to burst, ~3 minutes.

  6. 6

    Nestle spinach into the gaps and stir until wilted, ~1 minute.

  7. 7

    Crack eggs directly into the skillet, spacing them apart, then cover and cook until whites set but yolks jiggle, ~4 minutes.

  8. 8

    Slide halloumi back in, scatter feta if using, then serve straight from the pan.

Tools you’ll need

  • 10-inch non-stick or cast iron skillet
  • cutting board
  • chef's knife
  • slotted spatula
  • lid or large plate (for covering skillet)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.