CookSnap is coming soon — Join the waitlist →

Meatball Sub

Tender homemade meatballs simmered in marinara, piled into a crusty sub roll with melted mozzarella. Ready in 25 minutes.

Total time
25 min
Servings
2
Calories
620
Protein
38g
Meatball Sub
comfortcasualamericanbeeftendermeltyweeknightsandwich

Ingredients

  • ½ lb ground beef
  • ¼ cup panko breadcrumbs
  • 1 whole egg
  • 1.5 cups marinara sauce
  • 2 whole sub rolls
  • ¾ cup mozzarella cheese, shredded

Instructions

  1. 1

    Mix ground beef, breadcrumbs, egg, and a pinch each of salt and pepper in a bowl until just combined.

  2. 2

    Roll mixture into 8 meatballs about 1.5 inches across.

  3. 3

    Heat 1 tbsp olive oil in a skillet over medium-high until shimmering, about 1 minute.

  4. 4

    Add meatballs and cook without stirring for 3 minutes until bottoms brown.

  5. 5

    Roll meatballs to brown all sides, about 2 more minutes.

  6. 6

    Pour in marinara sauce and bring to a simmer over medium heat.

  7. 7

    Simmer for 6 minutes, stirring occasionally, until meatballs are cooked through.

  8. 8

    Split sub rolls open and place on a baking sheet. Heat under the broiler for 1 minute until lightly toasted.

  9. 9

    Divide meatballs and sauce between the two rolls.

  10. 10

    Top each sub with mozzarella. Return to broiler for 2 minutes until cheese melts and bubbles.

  11. 11

    Serve hot.

Tools you’ll need

  • mixing bowl
  • 12-inch skillet
  • wooden spoon
  • baking sheet
  • broiler

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.