Custrd is out on the App Store — Download it free →
Back to recipes

Meat Croquette

Crispy golden breaded patties filled with savory ground meat, perfect for a quick weeknight dinner. Serve with mustard and a sprinkle of parsley.

Total time
35 min
Servings
4
Calories
450
Protein
25g
Meat Croquette
comfortingAmericanbeefcrispyweeknightmaindinnerpan-fried

Ingredients

  • 1 lb ground beef
  • 1 medium onion
  • 1 large egg
  • 1 cup breadcrumbs
  • ½ cup flour
  • ½ cup vegetable oil
  • 1 tsp salt
  • ½ tsp black pepper

Instructions

  1. 1

    Finely chop the 1 medium onion. In a large bowl, combine the 1 lb ground beef, chopped onion, 1 tsp salt, and 0.5 tsp black pepper. Mix until just combined.

  2. 2

    Shape the mixture into 4 oval patties, about 1 inch thick. Place the 0.5 cup flour in a shallow dish, beat the 1 egg in another, and put the 1 cup breadcrumbs in a third.

  3. 3

    Dredge each patty in flour, then dip in the beaten egg, and finally coat with breadcrumbs, pressing gently to adhere.

  4. 4

    Heat the 0.5 cup vegetable oil in a large skillet over medium-high heat until shimmering, about 2 minutes. Carefully place the patties in the pan, making sure not to crowd them.

  5. 5

    Cook the croquettes until golden brown and cooked through, about 4-5 minutes per side. The internal temperature should reach 160°F and the crust should be crispy.

  6. 6

    Transfer to a paper towel-lined plate to drain. Serve hot with mustard and a sprinkle of fresh parsley if desired.

Tools you’ll need

  • Large skillet
  • Mixing bowl
  • Shallow dishes for breading
  • Paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.