Custrd is out on the App Store — Download it free →
Back to recipes

Mashed Potatoes with Bacon

Creamy mashed potatoes topped with crispy bacon and sautéed onions – a quick, comforting side or light meal ready in about 20 minutes.

Total time
20 min
Servings
4
Calories
350
Protein
10g
Mashed Potatoes with Bacon
comfortingamericanporkcreamycrispyweeknightsideside dish

Ingredients

  • 2 lb potatoes
  • 6 slices bacon
  • 1 medium onion
  • ½ cup milk
  • 2 tbsp butter
  • 1 tsp salt

Instructions

  1. 1

    Peel and chop the 2 lb potatoes into 1-inch chunks. Place in a pot, cover with cold water, add 1 tsp salt, and bring to a boil. Cook until fork-tender, about 15 minutes.

  2. 2

    While potatoes cook, chop the 6 bacon slices into small pieces. Cook in a skillet over medium heat until crispy, about 6 minutes. Remove bacon with a slotted spoon, leaving 1 tbsp drippings in the pan.

  3. 3

    Thinly slice the 1 medium onion and add to the skillet with the bacon drippings. Sauté over medium heat until soft and golden, about 5 minutes. Stir in the cooked bacon and set aside.

  4. 4

    Drain the potatoes and return to the pot. Add the 2 tbsp butter and 0.5 cup milk. Mash until smooth and creamy, seasoning with salt to taste.

  5. 5

    Serve the mashed potatoes topped with the bacon-onion mixture. Enjoy hot.

Tools you’ll need

  • pot
  • skillet
  • potato masher

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.