CookSnap is coming soon — Join the waitlist →
Back to recipes

Malaysian Roti Canai with Curry Dip

Crispy, flaky fried flatbread with a laminated dough, served with spiced curry dipping sauce. A showstopping vegetarian breakfast that looks harder than it is.

Total time
35 min
Servings
2
Calories
580
Protein
9g
Malaysian Roti Canai with Curry Dip
indulgentcomfortmalaysianvegetarianvegetariancrispyflakytender

Ingredients

  • 2 cups all-purpose flour
  • ½ tsp salt
  • ¾ cup warm water
  • 4 tbsp ghee or melted butter, divided
  • ½ medium onion, thinly sliced
  • 2 tsp curry powder
  • ¾ cup coconut milk
  • ½ tbsp lime juice

Instructions

  1. 1

    Mix flour and salt in a bowl. Add warm water slowly, stirring until shaggy dough forms.

  2. 2

    Knead dough 5–8 minutes on a floured surface until smooth and elastic.

  3. 3

    Divide dough into 4 equal balls. Brush each with ghee, cover, and rest 10 minutes.

  4. 4

    Heat 1 tbsp ghee in a small pan. Sauté onion 2–3 minutes until softened.

  5. 5

    Stir in curry powder and cook 30 seconds until fragrant, then add coconut milk.

  6. 6

    Simmer 4–5 minutes until thickened slightly. Finish with lime juice. Keep warm.

  7. 7

    Stretch one dough ball into a thin 8–10 inch circle on a lightly oiled surface.

  8. 8

    Heat 1 tbsp ghee in a 10-inch skillet over medium-high until shimmering, ~60 seconds.

  9. 9

    Slide roti into hot skillet. Cook 2–3 minutes until golden and crispy on bottom.

  10. 10

    Flip and cook another 1–2 minutes until bottom is spotted and crispy.

  11. 11

    Transfer to a plate. Repeat with remaining dough balls and ghee.

  12. 12

    Fold warm roti into triangles or roll loosely. Serve immediately with curry dip.

Tools you’ll need

  • mixing bowl
  • measuring cups and spoons
  • floured surface or cutting board
  • 10-inch non-stick or cast iron skillet
  • small saucepan
  • wooden spoon
  • whisk
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.