CookSnap is coming soon — Join the waitlist →
Back to recipes

Roti Canai with Dhal Curry

Crispy, flaky Malaysian flatbread made by stretching and folding dough, paired with a silky yellow lentil curry for dipping. A vegetarian breakfast showstopper that looks impressive but requires only basic pantry staples.

Total time
45 min
Servings
2
Calories
580
Protein
16g
Roti Canai with Dhal Curry
comfortrusticmalaysianvegetarianvegetariancrispyflakytender

Ingredients

  • 2 cups all-purpose flour
  • ¾ cup water
  • ½ tsp salt
  • 3 tbsp butter, melted
  • ½ cup yellow lentils (moong dal)
  • ½ medium onion, diced
  • ½ tsp turmeric powder
  • 2 clove garlic cloves, minced

Instructions

  1. 1

    Mix flour and salt in a bowl. Pour in water gradually, stirring until a shaggy dough forms.

  2. 2

    Knead dough on a lightly oiled counter for 5 minutes until smooth and slightly tacky.

  3. 3

    Divide dough into 4 equal balls. Cover with plastic wrap and rest 15 minutes.

  4. 4

    Rinse lentils. Boil in 2 cups salted water until completely soft, about 20 minutes.

  5. 5

    In a small skillet, heat 1 tbsp butter over medium. Sauté garlic and diced onion for 3 minutes until soft and fragrant.

  6. 6

    Stir turmeric into the garlic mixture. Cook 30 seconds until bloomed, then add cooked lentils.

  7. 7

    Simmer dhal for 5 minutes, stirring occasionally. Add salt and pepper to taste. Keep warm.

  8. 8

    Oil a work surface lightly. Flatten one dough ball into a thin 6-inch square with your hands.

  9. 9

    Drizzle 0.5 tsp melted butter over the dough, then fold into quarters like an envelope. Flatten gently.

  10. 10

    Heat a 10-inch skillet over medium-high until very hot, ~2 minutes. Lightly oil the surface.

  11. 11

    Place roti in the hot skillet. Cook 2 minutes until the bottom is light golden and puffed in spots.

  12. 12

    Flip and cook the other side 90 seconds until edges are golden brown and surface is crispy.

  13. 13

    Transfer to a plate. Repeat with remaining dough balls.

  14. 14

    Tear roti into pieces. Serve alongside warm dhal for dipping.

Tools you’ll need

  • large mixing bowl
  • 10-inch skillet
  • small skillet
  • 3-quart saucepan
  • wooden spoon
  • plastic wrap

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.