CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Roti Canai with Coconut Curry Dip

Flaky, buttery roti canai made from scratch in 25 minutes, served with a vibrant coconut curry dipping sauce. Golden-brown layers, tear-and-dip breakfast vibes.

Total time
25 min
Servings
2
Calories
520
Protein
8g
Crispy Roti Canai with Coconut Curry Dip
indulgentcomfortmalaysianvegetarianvegetariancrispyflakybreakfast

Ingredients

  • 1.5 cups all-purpose flour
  • 4 tbsp butter, divided
  • ¼ tsp salt
  • ¾ cup coconut milk
  • 1 tbsp curry powder
  • ½ medium onion, finely chopped
  • ½ whole lemon (juiced)

Instructions

  1. 1

    Mix flour and salt in a bowl, then add 0.5 cup water and 1 tbsp butter. Knead for 2 minutes until a soft dough forms.

  2. 2

    Divide dough into 4 balls, then oil and rest them for 5 minutes while you start the curry.

  3. 3

    In a small skillet, melt 1 tbsp butter over medium heat, then add chopped onion and cook until soft, ~2 minutes.

  4. 4

    Stir in curry powder for 30 seconds until fragrant, then add coconut milk and lemon juice. Simmer gently while you fry the roti.

  5. 5

    Roll out one dough ball thin on an oiled surface, then fold it like an accordion into thirds. Shape into a spiral.

  6. 6

    Heat 1 tbsp butter in a large skillet over medium-high heat, then pan-fry the roti spiral for 2 minutes per side until golden and crispy.

  7. 7

    Repeat with remaining dough balls. Serve warm roti torn into pieces alongside the warm curry dip.

Tools you’ll need

  • medium mixing bowl
  • small skillet (8-inch)
  • large skillet or griddle (12-inch)
  • rolling pin or wine bottle

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.