CookSnap is coming soon — Join the waitlist →
Back to recipes

Malaysian Curry Mee

A vibrant one-pan noodle curry with chicken and shrimp in a rich coconut sauce, ready in under 25 minutes. Aromatic, warming, and packed with bold Malaysian flavors.

Total time
25 min
Servings
2
Calories
520
Protein
38g
Malaysian Curry Mee
comfortmalaysianchickenshrimptendersilkyweeknightnoodle-soup

Ingredients

  • ½ lb chicken breast
  • ½ lb shrimp, large
  • 3 tbsp curry paste, Malaysian or yellow
  • 1 can (13.5 oz) coconut milk
  • 1 cup chicken or seafood broth
  • 5 oz dried rice noodles, thin
  • 1 whole lime, cut into wedges

Instructions

  1. 1

    Pat the chicken breast dry with paper towels, then place it on a cutting board and slice lengthwise with the grain into strips about 1/4-inch thick, about the width of your pinky finger.

  2. 2

    Check that the shrimp are peeled and deveined (tails can stay on); if they still have shells, peel them away with your fingers and pull out the dark vein running down the back.

  3. 3

    Bring a kettle of water to a boil, then pour the boiling water over the rice noodles in a bowl and let sit for 8 minutes until soft, then drain in a colander.

  4. 4

    Heat 2 tablespoons of oil in a large pot or skillet over medium-high heat until it shimmers and moves quickly when you tilt the pan, about 60 seconds.

  5. 5

    Add the curry paste to the hot oil and stir constantly for 30 seconds until it smells strong and fragrant, like roasted spices.

  6. 6

    Pour in the coconut milk and broth, stirring with a wooden spoon to break up any paste lumps, then bring to a simmer over medium heat.

  7. 7

    Add the chicken strips to the simmering curry and cook, stirring once every 30 seconds, for 5 minutes until the chicken turns white and opaque all the way through.

  8. 8

    Add the shrimp to the pot and cook, stirring gently, for 2 minutes until they turn pink and firm, no longer translucent.

  9. 9

    Add the drained noodles to the pot and stir gently for 1 minute until everything is coated in the curry sauce and heated through.

  10. 10

    Divide the curry and noodles between two bowls, pouring any remaining sauce from the pot over the top, then serve immediately with lime wedges on the side.

Tools you’ll need

  • kettle
  • large bowl
  • colander
  • large pot or 12-inch skillet
  • wooden spoon
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.