CookSnap is coming soon — Join the waitlist →
Back to recipes

Malaysian Devil Curry

A fiery one-pan curry loaded with mixed proteins and potatoes, built on a bold paste of chilies, garlic, and spices. Ready in 25 minutes with minimal prep.

Total time
25 min
Servings
2
Calories
468
Protein
42g
Malaysian Devil Curry
comfortboldmalaysianchickenshrimptendercreamyweeknight

Ingredients

  • 3 whole red chilies, fresh
  • 4 whole garlic cloves
  • ½ pound chicken breast, boneless and skinless
  • ½ pound medium shrimp, peeled and deveined
  • ¾ pound waxy potatoes (or baby potatoes)
  • 1 can (13.5 oz) coconut milk

Instructions

  1. 1

    Remove the stems from the 3 red chilies by pinching them off with your fingers, then scrape out the seeds inside using a small spoon—this reduces some heat but keeps the flavor bold.

  2. 2

    Place the 3 seeded chilies and 4 peeled garlic cloves into a blender or food processor and blend until they form a smooth red paste, about 1 minute.

  3. 3

    Cut the chicken breast into 1-inch cubes by slicing it lengthwise into three strips, then slicing each strip crosswise into 1-inch pieces.

  4. 4

    Cut the potatoes into 1-inch cubes by slicing them lengthwise, then rotating and slicing again, and finally cutting into 1-inch chunks.

  5. 5

    Heat 2 tablespoons of oil in a 12-inch skillet over medium-high heat until it shimmers and slides quickly when you tilt the pan, about 90 seconds.

  6. 6

    Pour the chili-garlic paste into the hot oil and stir constantly for 2 minutes until it smells strongly fragrant and darkens slightly in color.

  7. 7

    Add the chicken cubes to the paste and stir every 15 seconds for 3 minutes until the outside of each piece turns opaque white.

  8. 8

    Add the potato cubes and the 1 can of coconut milk, then stir until everything is coated and mixed together evenly.

  9. 9

    Lower the heat to medium and cover the skillet with a lid, then simmer for 10 minutes until the potatoes are fork-tender when pierced.

  10. 10

    Remove the lid and add the 0.5 pound of shrimp, then stir and cook uncovered for 2 minutes until the shrimp turn pink and opaque throughout.

  11. 11

    Taste the curry, then add salt and pepper to your preference.

Tools you’ll need

  • blender or food processor
  • 12-inch skillet with lid
  • cutting board
  • chef's knife
  • small spoon
  • wooden spoon or silicone spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.