Lox and Cream Cheese Bagel
A classic New York-style bagel topped with creamy cheese, silky lox, fresh greens, and dill. Quick to assemble and perfect for breakfast or brunch.
- Total time
- 10 min
- Servings
- 1
- Calories
- 420
- Protein
- 22g
comfortingindulgentamericanjewishpescatarianfishchewycreamy
Ingredients
- 1 whole bagel
- 2 tbsp cream cheese
- 2 oz lox (smoked salmon)
- 1 handful baby spinach
- 1 tbsp fresh dill
- 1 tsp lemon juice
- ¼ tsp black pepper
Instructions
- 1
Slice the 1 bagel in half horizontally and toast until golden and crisp, about 3-4 minutes.
- 2
In a small bowl, mix the 2 tbsp cream cheese with the 1 tsp lemon juice and 0.25 tsp black pepper until smooth.
- 3
Spread the cream cheese mixture evenly over both toasted bagel halves.
- 4
Layer the 2 oz lox over the cream cheese, folding it to cover the surface.
- 5
Top with the 1 handful baby spinach and sprinkle with the 1 tbsp fresh dill. Close the bagel and serve immediately.
Tools you’ll need
- toaster
- small bowl
- knife
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
