CookSnap is coming soon — Join the waitlist →
Back to recipes

Lemon Chicken

Bright, citrusy Chinese-style chicken with a glossy lemon sauce, ready in under 30 minutes. Pan-fried chicken thighs deliver tender meat and crispy edges that soak up the tangy glaze.

Total time
25 min
Servings
2
Calories
385
Protein
34g
Lemon Chicken
freshsimplechinesechickencrispytenderjuicyweeknight

Ingredients

  • 4 pieces (about 1.5 lbs) chicken thighs, bone-in skin-on
  • ⅓ cup lemon juice, fresh
  • 3 tablespoons soy sauce
  • 2 cloves garlic, minced
  • 1 tablespoon sugar
  • 1 teaspoon ginger, minced

Instructions

  1. 1

    Pat the chicken thighs dry with paper towels by pressing gently all over, removing any surface moisture so they will brown better.

  2. 2

    In a small bowl, whisk together the lemon juice, soy sauce, sugar, minced garlic, and minced ginger until the sugar dissolves completely.

  3. 3

    Heat 2 tablespoons of olive oil in a large skillet over medium-high heat until it shimmers and slides quickly when you tilt the pan, about 90 seconds.

  4. 4

    Place the chicken thighs skin-side down in the hot oil; you should hear a vigorous sizzle as they hit the pan.

  5. 5

    Let the chicken cook skin-side down without moving it for 7 minutes until the skin is golden-brown and the meat releases easily when you lift the edge with a fork.

  6. 6

    Flip each chicken thigh over using tongs, placing it flesh-side down in the same skillet.

  7. 7

    Cook for another 5 minutes until the flesh side is opaque and no longer pink when you cut into the thickest part near the thigh bone.

  8. 8

    Pour the lemon sauce mixture over the chicken in the skillet, being careful to pour around—not directly onto—the skin to keep it crispy.

  9. 9

    Reduce heat to medium-low and simmer uncovered for 3 minutes, tilting the pan occasionally so the sauce pools under and around the chicken.

  10. 10

    Transfer the chicken thighs to a serving plate skin-side up, then pour the remaining sauce from the skillet over the top.

Tools you’ll need

  • 12-inch skillet or large frying pan
  • paper towels
  • small bowl
  • whisk
  • kitchen tongs
  • fork
  • measuring spoons
  • measuring cup

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.