CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Chicken Alla Romana

Tender pan-seared chicken thighs with crispy edges, finished in a bright lemon-white wine sauce with tomatoes and fresh herbs. One skillet, weeknight-easy, and ready in 20 minutes.

Total time
20 min
Servings
4
Calories
385
Protein
38g
Chicken Alla Romana
freshsimpleitalianchickencrispytenderjuicyweeknight

Ingredients

  • 4 pieces (about 6 oz each) boneless, skin-on chicken thighs
  • 1.5 cups cherry tomatoes, halved
  • ½ cup dry white wine (or chicken broth)
  • 1 whole (juiced + zested) lemon
  • ¼ cup fresh parsley (or basil), chopped
  • 3 cloves garlic, minced

Instructions

  1. 1

    Pat chicken thighs dry with paper towels. Season generously with salt and pepper on both sides.

  2. 2

    Heat olive oil in a large skillet over medium-high. Once shimmering, lay chicken skin-side down without moving it.

  3. 3

    Sear skin-side down 6 minutes until golden and crispy. Flip and cook 4 minutes more until cooked through.

  4. 4

    Push chicken to the side. Add garlic to the empty space and cook 30 seconds until fragrant.

  5. 5

    Pour in wine and lemon juice, scraping up any browned bits from the pan. Add tomatoes and stir gently.

  6. 6

    Simmer 3 minutes until tomatoes soften and sauce reduces slightly. Stir in lemon zest and parsley. Serve hot.

Tools you’ll need

  • 12-inch skillet with lid or cover
  • paper towels
  • wooden spoon or silicone spatula
  • microplane or zester
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.