CookSnap is coming soon — Join the waitlist →
Back to recipes

Larb Pla Duk (Spicy Catfish Salad)

Crispy catfish tossed with lime, fish sauce, and fresh herbs in a vibrant Thai salad. Ready in 25 minutes and bursting with spicy, tangy, umami flavor.

Total time
25 min
Servings
2
Calories
298
Protein
28g
Larb Pla Duk (Spicy Catfish Salad)
freshboldthaifishcrispytenderweeknightsalad

Ingredients

  • ¾ lb catfish fillets, skinless
  • 1 whole lime (zested and juiced)
  • 2 tbsp fish sauce
  • 1 whole fresh Thai chili (red or bird's eye), thinly sliced
  • ½ cup fresh mint and cilantro leaves, torn or chopped
  • 2 medium shallots, thinly sliced into rings

Instructions

  1. 1

    Pat the catfish fillets dry on both sides with paper towels, pressing gently to remove excess moisture so they will crisp when cooked.

  2. 2

    Slice each catfish fillet lengthwise into 4 long strips, about 0.5 inches wide, following the natural grain of the meat.

  3. 3

    Pour 2 tablespoons of lime juice and 2 tablespoons of fish sauce into a small bowl and stir to combine; set on the counter.

  4. 4

    Thinly slice the Thai chili crosswise into rings, discarding the stem end; tear or chop the mint and cilantro into bite-sized pieces.

  5. 5

    Set a 12-inch nonstick skillet over medium-high heat and add 3 tablespoons of neutral oil, waiting until the oil shimmers and slides quickly when you tilt the pan, about 90 seconds.

  6. 6

    Carefully lay the catfish strips into the hot oil in a single layer and cook without moving them for 3 minutes until the bottoms turn golden-brown and crispy.

  7. 7

    Flip each strip over gently with a spatula and cook the other side for 2 minutes until golden and the fish flakes easily when pressed with the spatula.

  8. 8

    Transfer the cooked catfish strips to a cutting board and let rest for 1 minute, then cut each strip into 2-inch chunks.

  9. 9

    Place the catfish chunks in a medium bowl, drizzle with the lime-fish sauce mixture, and toss gently until evenly coated.

  10. 10

    Add the lime zest, sliced shallots, sliced Thai chili, and half the mint and cilantro to the bowl and toss gently to combine.

  11. 11

    Divide the larb between two plates and scatter the remaining fresh herbs on top.

Tools you’ll need

  • 12-inch nonstick skillet
  • paper towels
  • cutting board
  • chef's knife
  • small bowl
  • spatula
  • medium mixing bowl
  • two dinner plates

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.