CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Catfish Salad with Thai Lime Dressing

Panfried catfish fillets with a shatteringly crisp crust sit atop a cool, herbaceous salad dressed in a bright lime-fish sauce vinaigrette. Authentic Thai flavors, 20 minutes start to finish.

Total time
20 min
Servings
2
Calories
340
Protein
28g
Crispy Catfish Salad with Thai Lime Dressing
lightfreshthaifishcrispytenderweeknightlunch

Ingredients

  • ½ lb catfish fillets
  • 3 tbsp cornstarch
  • 1 pinch salt and black pepper to taste
  • 3 cups mixed salad greens (arugula, leaf lettuce, or romaine)
  • ½ cup fresh cilantro and mint, torn
  • ½ medium cucumber, thinly sliced
  • 3 tbsp lime juice
  • 1 tbsp fish sauce
  • 2 tbsp olive oil for cooking plus 1 tbsp for dressing

Instructions

  1. 1

    Pat catfish dry with paper towels. Season both sides generously with salt and pepper.

  2. 2

    Toss catfish in a shallow bowl with cornstarch until evenly coated on both sides.

  3. 3

    Whisk lime juice, fish sauce, and 1 tbsp olive oil in a small bowl until combined.

  4. 4

    Heat 2 tbsp olive oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  5. 5

    Sear catfish 3–4 minutes per side without moving until golden brown and crispy.

  6. 6

    Transfer catfish to a plate and let cool for 1 minute, then break into bite-sized pieces.

  7. 7

    Toss greens, herbs, and cucumber with the lime-fish sauce dressing in a large bowl.

  8. 8

    Divide salad between two plates and top each with half the crispy catfish pieces.

  9. 9

    Serve immediately while catfish is still warm.

Tools you’ll need

  • paper towels
  • shallow bowl
  • small bowl
  • whisk
  • 12-inch skillet
  • tongs
  • large mixing bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.