Custrd is out on the App Store — Download it free →
Back to recipes

Korean Beef and Vegetable Stir-Fry Noodles

A quick and satisfying weeknight stir-fry with tender beef, crisp vegetables, and chewy noodles tossed in a savory-sweet sauce. Ready in about 30 minutes, this dish brings Korean flavors to your table with minimal fuss.

Total time
30 min
Servings
2
Calories
520
Protein
28g
Korean Beef and Vegetable Stir-Fry Noodles
comfortingKoreandairy-freebeefchewycrispweeknightstir-fry

Ingredients

  • ½ lb beef sirloin, thinly sliced
  • 3 tbsp soy sauce
  • 1 tbsp brown sugar
  • 2 cloves garlic, minced
  • 1 tbsp sesame oil
  • 1 medium carrot, julienned
  • 1 cup snap peas
  • 8 oz cooked noodles (such as udon or lo mein)

Instructions

  1. 1

    In a small bowl, mix 3 tbsp soy sauce, 1 tbsp brown sugar, 2 minced garlic cloves, and 1 tbsp sesame oil. Set aside.

  2. 2

    Heat a large skillet or wok over high heat. Add 1 tbsp vegetable oil and 0.5 lb sliced beef. Stir-fry until browned, about 3-4 minutes. Remove beef from skillet.

  3. 3

    In the same skillet, add 1 julienned carrot and 1 cup snap peas. Stir-fry for 2-3 minutes until crisp-tender.

  4. 4

    Add 8 oz cooked noodles and the sauce mixture. Toss everything together for 2 minutes until noodles are heated through and coated.

  5. 5

    Return the beef to the skillet. Stir-fry for 1 more minute until everything is well combined and hot.

  6. 6

    Garnish with sliced scallions and sesame seeds if desired. Serve immediately.

Tools you’ll need

  • Large skillet or wok
  • Small bowl
  • Cutting board
  • Knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.