CookSnap is coming soon — Join the waitlist →

Kimchi Pancake (Kimchi Jeon)

Crispy, golden Korean pancake loaded with tangy kimchi and scallions. A beloved appetizer that's savory, spicy, and utterly addictive.

Total time
20 min
Servings
2
Calories
320
Protein
7g
Kimchi Pancake (Kimchi Jeon)
Koreanappetizersidekoreanvegetariancrispykimchidairy-free

Ingredients

  • 1.5 cup kimchi, chopped
  • ¾ cup all-purpose flour
  • ½ cup water
  • 1 large egg
  • 2 tbsp scallions, chopped
  • 2 tbsp kimchi juice (from jar)
  • 3 tbsp vegetable oil
  • ¼ tsp salt
  • ½ tsp sesame seeds

Instructions

  1. 1

    In a medium mixing bowl, whisk together flour, water, egg, and kimchi juice until you have a smooth, slightly thick batter—similar to pancake batter but thinner. Season with salt and stir gently until just combined.

  2. 2

    Fold in the chopped kimchi and scallions until evenly distributed throughout the batter. Reserve any extra kimchi pieces to press into the pancake while cooking for extra flavor and texture.

  3. 3

    Heat vegetable oil in a large skillet over medium-high heat until shimmering, about 1 minute. Pour the batter into the center and spread gently into a thin, even circle about 6-8 inches wide using a spatula.

  4. 4

    Cook undisturbed for 4-5 minutes until the underside is deeply golden brown and crispy. Press gently with the spatula occasionally to ensure even browning and crispiness.

  5. 5

    Carefully flip the pancake and cook the other side for 3-4 minutes until golden and crispy. Transfer to a cutting board and sprinkle sesame seeds over the top while still warm.

  6. 6

    Cut the pancake into bite-sized squares or triangles and serve immediately with a small bowl of soy sauce mixed with a touch of rice vinegar for dipping, if desired.

Tools you’ll need

  • Medium mixing bowl
  • Large skillet
  • Spatula
  • Whisk
  • Cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.