20-Min Kielbasa Veggie Skillet
Sliced kielbasa and frozen mixed veggies sear together in one skillet with garlic powder for a quick, satisfying dinner. Ready in under 20 minutes with zero fuss.
- Total time
- 18 min
- Servings
- 4
- Calories
- 385
- Protein
- 22g
quicksatisfyingamericanporkcrispytenderweeknightmain-dish
Ingredients
- 1 lb kielbasa
- 3 cups frozen mixed vegetables
- 2 tbsp olive oil
- 1 tsp garlic powder
Instructions
- 1
Slice kielbasa into 1/4-inch rounds.
- 2
Heat oil in a large skillet over medium-high until shimmering, about 90 seconds.
- 3
Add kielbasa and sear 3 minutes until edges brown, stirring once halfway through.
- 4
Stir in frozen vegetables and garlic powder, then cook 5 minutes until heated through.
- 5
Season with salt and pepper to taste, then serve hot.
Tools you’ll need
- 12-inch skillet
- cutting board
- knife
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
