CookSnap is coming soon — Join the waitlist →
Back to recipes

Kaya Toast with Soft Eggs & Lime

Crispy buttered toast spread with sweet coconut kaya, paired with jammy soft-boiled eggs and cooling cucumber slices. A Malaysian breakfast classic ready in under 10 minutes.

Total time
10 min
Servings
2
Calories
385
Protein
12g
Kaya Toast with Soft Eggs & Lime
casualquickmalaysianvegetarianeggscrispycreamysoft

Ingredients

  • 4 tbsp kaya (coconut jam)
  • 4 slices bread (white or brioche)
  • 2 tbsp butter
  • 4 whole eggs
  • 1 whole cucumber
  • 1 whole calamansi lime or lime

Instructions

  1. 1

    Bring a small pot of salted water to a boil. Gently lower eggs and cook for 6–7 minutes until whites are set but yolks still jiggle.

  2. 2

    While eggs cook, spread kaya on one side of each bread slice. Heat butter in a large skillet over medium heat until it foams.

  3. 3

    Toast kaya-spread bread in the butter for 2–3 minutes per side until golden and crispy, pressing gently.

  4. 4

    Slice cucumber into thin rounds. Cut calamansi or lime into wedges for squeezing.

  5. 5

    Remove eggs from water and crack into a small bowl. Plate toast, eggs, cucumbers, and lime wedges together.

  6. 6

    Serve immediately while toast is still warm and eggs are soft.

Tools you’ll need

  • small pot
  • large skillet
  • cutting board
  • knife
  • slotted spoon
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Malaysian recipes →